Welcome to daughtersonboutique
Default Language
Default Default
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
I am cover by the blood of Jesus large Scarf
I am cover by the blood of Jesus large Scarf
I am cover by the blood of Jesus large Scarf
I am cover by the blood of Jesus large Scarf

I am cover by the blood of Jesus large Scarf

Product Code: Y4qLAeK
Product Condition: New
Units in Stock: 10
$24.00
$22.80 inc. tax
$22.80 ex. tax
? Tax based on California, United States.
 Add to Cart
Description
With FREE SHIPPING. Returning is acceptabble however customer will pay for the return.
This piece is a blessing piece to cover your head. Please note we DO NOT ACCEPT ANY ITEM BACK.
Thank you for shopping at daughtersonboutique.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i