Welcome to daughtersonboutique
Default Language
Default Default
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Large Bonnet Sleep with the blood of Jesus
Large Bonnet Sleep with the blood of Jesus
Large Bonnet Sleep with the blood of Jesus
Large Bonnet Sleep with the blood of Jesus
Large Bonnet Sleep with the blood of Jesus
Large Bonnet Sleep with the blood of Jesus

Large Bonnet Sleep with the blood of Jesus

Product Code: PyA2V8W
Product Condition: New
Units in Stock: 10
$26.00 inc. tax
$25.00 ex. tax
? Tax based on California, United States.
 Add to Cart
Description
With FREE SHIPPING. Returning is acceptabble however customer will pay for the return.
Large Bonnet I am cover with the blood of Jesus while sleep for people with Dreadlocks and braid hair
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i