Welcome to daughtersonboutique
Default Language
Default Default
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
7x7 in (17.8x17.8cm My family is coverd by the blood of Jesus
7x7 in (17.8x17.8cm My family is coverd by the blood of Jesus
7x7 in (17.8x17.8cm My family is coverd by the blood of Jesus
7x7 in (17.8x17.8cm My family is coverd by the blood of Jesus

7x7 in (17.8x17.8cm My family is coverd by the blood of Jesus

Product Code: HKB9y31
Product Condition: New
Units in Stock: 3
$7.28 inc. tax
$7.00 ex. tax
? Tax based on California, United States.
 Add to Cart
Description

Photo Fram with i'm coverd by the Blood of Jesus. 

You can hangs it by your door entrece or inthe room where you are sleeping specially in the kids room.

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i